Ir al contenido principal.
Enlaces relacionados:  Presse  Société  Clientes  Nous contacter
Solsoft

Posibles usos para bases de datos CDS/ISIS (OpenIsis): Bioinformática

Proteínas

Ejemplo tomado de http://www.rcsb.org/:

Title: Synergistic Inhibition Of Glycogen Phosphorylase A By A Potential Antidiabetic Drug and Caffeine
Compound: Mol_Id: 1; Molecule: Glycogen Phosphorylase; Chain: A; Ec: 2.4.1.1
Authors: K. E. Tsitsanou, V. T. Skamnaki, N. G. Oikonomakos
Exp. Method: X-ray Diffraction
Classification: Transferase
EC Number: 2.4.1.1 (Phosphorylase)
Source: Oryctolagus cuniculus
Primary Citation: Tsitsanou, K. E., Skamnaki, V. T., Oikonomakos, N. G.: Structural Basis of the Synergistic Inhibition of Glycogen Phosphorylase a by Caffeine and a Potential Antidiabetic Drug Arch.Biochem.Biophys. 384 pp. 245 (2002) 
 
Deposition Date: 16-May-2000 Release Date: 31-May-2000
 
Resolution [Å]: 2.30 R-Value: 0.210
Space Group: P 43 21 2  
Unit Cell:
dim [Å]: a 126.69 b 126.69 c 115.30
angles [°]: alpha 90.00 beta 90.00 gamma 90.00
 
Polymer Chains: A Residues: 842
Atoms: 7378
Chemical Components:
("HET" groups)
ID
(needs Rasmol)
Name Formula Retrieve All PDB IDs Containing
BIN 2,3-DICARBOXY-4-(2-CHLORO-PHENYL)-1-ETHYL-
5-ISOPROPOXYCARBONYL-6-METHYL-PYRIDINIUM
C20H21NO6Cl BIN
CFF CAFFEINE C8H10N4O2 CFF
GOL GLYCEROL C3H8O3 GOL
PLP PYRIDOXAL-5'-PHOSPHATE C8H10NO6P PLP
SEP PHOSPHOSERINE C3H8NO6P SEP
 
CATH: Structural Classification
SCOP: Structural Classification

Nucleótidos

Ejemplo tomado de http://www.ebi.ac.uk/embl/:

ID   TRBG361    standard; mRNA; PLN; 1859 BP.
XX
AC X56734; S46826;
XX
SV X56734.1
XX
DT 12-SEP-1991 (Rel. 29, Created)
DT 15-MAR-1999 (Rel. 59, Last updated, Version 9)
XX
DE Trifolium repens mRNA for non-cyanogenic beta-glucosidase
XX
KW beta-glucosidase.
XX
OS Trifolium repens (white clover)
OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; rosids;
OC eurosids I; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium.
XX
RN [5]
RP 1-1859
RX MEDLINE; 91322517.
RX PUBMED; 1907511.
RA Oxtoby E., Dunn M.A., Pancoro A., Hughes M.A.;
RT "Nucleotide and derived amino acid sequence of the cyanogenic
RT beta-glucosidase (linamarase) from white clover (Trifolium repens L.).";
RL Plant Mol. Biol. 17(2):209-219(1991).
XX
RN [6]
RP 1-1859
RA Hughes M.A.;
RT ;
RL Submitted (19-NOV-1990) to the EMBL/GenBank/DDBJ databases.
RL M.A. Hughes, UNIVERSITY OF NEWCASTLE UPON TYNE, MEDICAL SCHOOL, NEW CASTLE
RL UPON TYNE, NE2 4HH, UK
XX
DR GOA; P26204.
DR MENDEL; 11000; Trirp;1162;11000.
DR SWISS-PROT; P26204; BGLS_TRIRP.
XX
FH Key Location/Qualifiers
FH
FT source 1..1859
FT /db_xref="taxon:3899"
FT /mol_type="mRNA"
FT /organism="Trifolium repens"
FT /tissue_type="leaves"
FT /clone_lib="lambda gt10"
FT /clone="TRE361"
FT CDS 14..1495
FT /db_xref="GOA:P26204"
FT /db_xref="SWISS-PROT:P26204"
FT /note="non-cyanogenic"
FT /EC_number="3.2.1.21"
FT /product="beta-glucosidase"
FT /protein_id="CAA40058.1"
FT /translation="MDFIVAIFALFVISSFTITSTNAVEASTLLDIGNLSRSSFPRGFI
FT FGAGSSAYQFEGAVNEGGRGPSIWDTFTHKYPEKIRDGSNADITVDQYHRYKEDVGIMK
FT DQNMDSYRFSISWPRILPKGKLSGGINHEGIKYYNNLINELLANGIQPFVTLFHWDLPQ
FT VLEDEYGGFLNSGVINDFRDYTDLCFKEFGDRVRYWSTLNEPWVFSNSGYALGTNAPGR
FT CSASNVAKPGDSGTGPYIVTHNQILAHAEAVHVYKTKYQAYQKGKIGITLVSNWLMPLD
FT DNSIPDIKAAERSLDFQFGLFMEQLTTGDYSKSMRRIVKNRLPKFSKFESSLVNGSFDF
FT IGINYYSSSYISNAPSHGNAKPSYSTNPMTNISFEKHGIPLGPRAASIWIYVYPYMFIQ
FT EDFEIFCYILKINITILQFSITENGMNEFNDATLPVEEALLNTYRIDYYYRHLYYIRSA
FT IRAGSNVKGFYAWSFLDCNEWFAGFTVRFGLNFVD"
FT mRNA 1..1859
FT /evidence=EXPERIMENTAL
XX
SQ Sequence 1859 BP; 609 A; 314 C; 355 G; 581 T; 0 other;
aaacaaacca aatatggatt ttattgtagc catatttgct ctgtttgtta ttagctcatt 60
cacaattact tccacaaatg cagttgaagc ttctactctt cttgacatag gtaacctgag 120
tcggagcagt tttcctcgtg gcttcatctt tggtgctgga tcttcagcat accaatttga 180
aggtgcagta aacgaaggcg gtagaggacc aagtatttgg gataccttca cccataaata 240
tccagaaaaa ataagggatg gaagcaatgc agacatcacg gttgaccaat atcaccgcta 300
caaggaagat gttgggatta tgaaggatca aaatatggat tcgtatagat tctcaatctc 360
ttggccaaga atactcccaa agggaaagtt gagcggaggc ataaatcacg aaggaatcaa 420
atattacaac aaccttatca acgaactatt ggctaacggt atacaaccat ttgtaactct 480
ttttcattgg gatcttcccc aagtcttaga agatgagtat ggtggtttct taaactccgg 540
tgtaataaat gattttcgag actatacgga tctttgcttc aaggaatttg gagatagagt 600
gaggtattgg agtactctaa atgagccatg ggtgtttagc aattctggat atgcactagg 660
aacaaatgca ccaggtcgat gttcggcctc caacgtggcc aagcctggtg attctggaac 720
aggaccttat atagttacac acaatcaaat tcttgctcat gcagaagctg tacatgtgta 780
taagactaaa taccaggcat atcaaaaggg aaagataggc ataacgttgg tatctaactg 840
gttaatgcca cttgatgata atagcatacc agatataaag gctgccgaga gatcacttga 900
cttccaattt ggattgttta tggaacaatt aacaacagga gattattcta agagcatgcg 960
gcgtatagtt aaaaaccgat tacctaagtt ctcaaaattc gaatcaagcc tagtgaatgg 1020
ttcatttgat tttattggta taaactatta ctcttctagt tatattagca atgccccttc 1080
acatggcaat gccaaaccca gttactcaac aaatcctatg accaatattt catttgaaaa 1140
acatgggata cccttaggtc caagggctgc ttcaatttgg atatatgttt atccatatat 1200
gtttatccaa gaggacttcg agatcttttg ttacatatta aaaataaata taacaatcct 1260
gcaattttca atcactgaaa atggtatgaa tgaattcaac gatgcaacac ttccagtaga 1320
agaagctctt ttgaatactt acagaattga ttactattac cgtcacttat actacattcg 1380
ttctgcaatc agggctggct caaatgtgaa gggtttttac gcatggtcat ttttggactg 1440
taatgaatgg tttgcaggct ttactgttcg ttttggatta aactttgtag attagaaaga 1500
tggattaaaa aggtacccta agctttctgc ccaatggtac aagaactttc tcaaaagaaa 1560
ctagctagta ttattaaaag aactttgtag tagattacag tacatcgttt gaagttgagt 1620
tggtgcacct aattaaataa aagaggttac tcttaacata tttttaggcc attcgttgtg 1680
aagttgttag gctgttattt ctattatact atgttgtagt aataagtgca ttgttgtacc 1740
agaagctatg atcataacta taggttgatc cttcatgtat cagtttgatg ttgagaatac 1800
tttgaattaa aagtcttttt ttattttttt aaaaaaaaaa aaaaaaaaaa aaaaaaaaa 1859


Copyright © 2003-2009, Solsoft de Costa Rica S.A.
Charte de confidentialité